Search
“map. web”
More pages from the web
26–30 of 1,396-
conference-hub.com
conferences, webinars, events, exhibition & workshops, events & exposition, seminars - Conference-Hub.com
new popup web 2 another content encluded in here Home My account Blog Site Map Contact Twitter Facebook Welcome to Conference-hub, your source for Conferences, Webinars, Events, Exhibition & Workshops, Events & Expositions, and Seminars All Major CategoriesARTS & CRAFTSBUSINESSCOMMUNITYCOMPUTERS and INTERNETEDUCATIONFOOD / DININGHEALTH / MEDICINELEGALMARKETINGNEWSPHYSICAL and LIFE SCIENCESREGIONAL STUDIESSCIENCE and TECHNOLOGYSOCIAL SCIENCE && HUMANITIESSOCIETYSPORTS, OUTDOORS and RECREATIONAll
-
proactive-web.com
Proactive-Web.Com - Philippines Web Site Design and Development Services Company, PHP Web Site Application Designer and Developer Philippines, Web
About Proactive-WebContact Us Some of Our Clients Request for a Quote or Appointment Site Map Proactive-Web.Com 10 Years of Professional Web Development, Ecommerce, Hosting, Domain Registration & SEO Services in the Philippines About Proactive-Web Proact
-
callupcontact.com/b/businessprofile/Ma_Web_Technologies/6743972
Ma Web Technologies in Gurgaon - Haryana - Contact Us, Phone Number, Address and Map
Ma Web Technologies is a dominate Web Development and site Design Company in Gurgaon India. We provide world professional web design and Development service. Ma web Technologies develop all type software like as: ERP development, HMIS Development and E-commerce etc
-
0-flash-ad-flash-intro-flash-web-site-templates.com
Flash templates, flash design, Flash Builder, web site templates, Flash intros, flash map, flash template,flash ads, music players
Flash Templates, web templates, and Flash Design Resources. A4Desk Flash Site Builder, Flash softwares. For cd presentations, web site design, and flash intros for digital signage
-
bizfinder.registerguard.com/tedrico+s+page+web+page+design+and+promotion+service.9.116957841p.home.html
Tedrico's Page Web Page Design and Promotion Service in Philomath, OR
Information on Tedrico's Page Web Page Design and Promotion Service in Philomath. (541) 929-8181. Address, phone number, map, driving directions, hours of operation, services, reviews and more for Tedrico's Page Web Page Design and Promotion Service